EpCAM Recombinant Rabbit mAb - #BF3401

(1)   Copy Info
Product: EpCAM Recombinant Rabbit mAb
Catalog: BF3401
Description: Rabbit monoclonal antibody to EpCAM
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 35-40kD(Observed); 35kD(Calculated).
Uniprot: P16422

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:1000-1:10000, IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm22848]
Specificity:
EpCAM Recombinant Rabbit mAb detects endogenous levels of EpCAM.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal antibody AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component, chromosome 4, surface marker 1; Membrane component, chromosome 4, surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1;

Immunogens

Immunogen:

A synthetic peptide from human EpCAM

Uniprot:

P16422(EPCAM_HUMAN) >>Visit HPA database.

Gene(ID):
EPCAM(4072)
Expression:
P16422 EPCAM_HUMAN:

Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Description:
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Sequence:
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

Research Backgrounds

Function:

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

PTMs:

Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability.

Subcellular Location:

Lateral cell membrane>Single-pass type I membrane protein. Cell junction>Tight junction.
Note: Colocalizes with CLDN7 at the lateral cell membrane and tight junction.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Family&Domains:

Belongs to the EPCAM family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.