CXCL14 Recombinant Rabbit mAb - #BF3465

Copy Info
Product: CXCL14 Recombinant Rabbit mAb
Catalog: BF3465
Description: Rabbit monoclonal antibody to CXCL14
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 12 kDa(Observed); 13kD(Calculated).
Uniprot: O95715

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm22912]
Specificity:
CXCL14 Recombinant Rabbit mAb detects endogenous levels of CXCL14.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

1110031L23Rik; 1200006I23Rik; AI414372; BMAC; bolekine; BRAK; Breast and kidney; C-X-C motif chemokine 14; C-X-C motif chemokine ligand 14; Chaemokine, CXC motif, ligand 14; Chemokine (C-X-C motif) ligand 14; Chemokine BRAK; CXC chemokine in breast and kidney; CXCL14; CXL14_HUMAN; JSC; Kec; Kidney-expressed chemokine CXC; KS1; MGC10687; MGC124510; MGC90667; MIP 2 gamma; MIP-2G; MIP2G; MIP2gamma; NJAC; PRO273; PSEC0212; Scyb14; Small Inducible Cytokine B14; Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK); Small Inducible Cytokine subfamily B, member 14; Small-inducible cytokine B14; Tumor suppressing chemokine; UNQ240;

Immunogens

Immunogen:

A synthetic peptide from human CXCL14

Uniprot:

O95715(CXL14_HUMAN) >>Visit HPA database.

Gene(ID):
CXCL14(9547)
Expression:
O95715 CXL14_HUMAN:

Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.

Description:
This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes,dendritic cells,neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Sequence:
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Research Backgrounds

Function:

Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.

PTMs:

Ubiquitinated, followed by degradation by the proteasome.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.

Family&Domains:

The destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.