Product: CD83 Recombinant Rabbit mAb
Catalog: BF3533
Description: Rabbit monoclonal antibody to CD83
Application: WB
Reactivity: Human, Rat
Mol.Wt.: 23-65 kDa(Observed); 23kD(Calculated).
Uniprot: Q01151

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Rat
Clonality:
Monoclonal [ReFirm22980]
Specificity:
CD83 Recombinant Rabbit mAb detects endogenous levels of CD83.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

B cell activation 45kDa cell surface glycoprotein Ig superfamily; B cell activation protein; B-cell activation protein; BL11; BL11 PEN; CD83; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); CD83 antigen; CD83 molecule; CD83_HUMAN; Cell surface glycoprotein; Cell surface protein HB15; HB15; hCD83;

Immunogens

Immunogen:

A synthetic peptide from human CD83

Uniprot:
Gene(ID):
Expression:
Q01151 CD83_HUMAN:

Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.

Description:
The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
Sequence:
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Research Backgrounds

Function:

May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Subcellular Location:

Membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.