S100B Recombinant Rabbit mAb - #BF3545

Copy Info
Product: S100B Recombinant Rabbit mAb
Catalog: BF3545
Description: Rabbit monoclonal antibody to S100B
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 11 kDa(Observed); 11kD(Calculated).
Uniprot: P04271

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, IHC 1:200-1:1000, IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm22992]
Specificity:
S100B Recombinant Rabbit mAb detects endogenous levels of S100B.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

NEF; Protein S100 B; Protein S100-B; S 100 calcium binding protein beta chain; S 100 protein beta chain; S-100 protein beta chain; S-100 protein subunit beta; S100; S100 calcium binding protein beta (neural); S100 calcium-binding protein B; S100 protein beta chain; S100B; S100B_HUMAN; S100beta;

Immunogens

Immunogen:

A synthetic peptide from human S100B

Uniprot:

P04271(S100B_HUMAN) >>Visit HPA database.

Gene(ID):
S100B(6285)
Expression:
P04271 S100B_HUMAN:

Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.

Description:
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and,or nucleus of a wide range of cells,and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21,however,this gene is located at 21q22.3. This protein may function in Neurite extension,proliferation of melanoma cells,stimulation of Ca2+ fluxes,inhibition of PKC-mediated phosphorylation,astrocytosis and axonal proliferation,and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological,neoplastic,and other types of diseases,including Alzheimer's disease,Down's syndrome,epilepsy,amyotrophic lateral sclerosis,melanoma,and type I diabetes.
Sequence:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Research Backgrounds

Function:

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.

Family&Domains:

Belongs to the S-100 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.