CD24 Recombinant Rabbit mAb - #BF3609

(1)   Copy Info
Product: CD24 Recombinant Rabbit mAb
Catalog: BF3609
Description: Rabbit monoclonal antibody to CD24
Application: WB
Reactivity: Human
Mol.Wt.: 30-70 kDa(Observed); 8kD(Calculated).
Uniprot: P25063

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23056]
Specificity:
CD24 Recombinant Rabbit mAb detects endogenous levels of CD24.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD 24; CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 antigen; CD24 molecule; CD24_HUMAN; CD24A; FLJ22950; FLJ43543; GPI linked surface mucin; Heat stable antigen; HSA; MGC75043; Nectadrin; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen;

Immunogens

Immunogen:

A synthetic peptide from human CD24

Uniprot:

P25063(CD24_HUMAN) >>Visit HPA database.

Gene(ID):
CD24(100133941)
Expression:
P25063 CD24_HUMAN:

B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.

Description:
This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies,but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1,15,20,and Y. Alternative splicing results in multiple transcript variants.
Sequence:
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Research Backgrounds

Function:

May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity (By similarity).

PTMs:

Extensively O-glycosylated.

Subcellular Location:

Cell membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.

Family&Domains:

Belongs to the CD24 family.

Research Fields

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.