TFF3 Recombinant Rabbit mAb - #BF3621

Copy Info
Product: TFF3 Recombinant Rabbit mAb
Catalog: BF3621
Description: Rabbit monoclonal antibody to TFF3
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 10 kDa(Observed); 10kD(Calculated).
Uniprot: Q07654

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC: 1:100-1:500, IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23068]
Specificity:
TFF3 Recombinant Rabbit mAb detects endogenous levels of TFF3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

hITF; hP1.B; Intestinal trefoil factor; ITF; mITF; OTTMUSP00000021729; P1B; Polypeptide P1.B; TFF3; TFF3_HUMAN; TFI; TREFOIL; Trefoil factor (intestinal); Trefoil factor 3;

Immunogens

Immunogen:

A synthetic peptide from human TFF3

Uniprot:

Q07654(TFF3_HUMAN) >>Visit HPA database.

Gene(ID):
TFF3(7033)
Expression:
Q07654 TFF3_HUMAN:

Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level).

Description:
Members of the trefoil family are characterized by having at least one copy of the trefoil motif,a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined,but they may protect the mucosa from insults,stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Sequence:
MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Research Backgrounds

Function:

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix. Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.