Product: S100 A1 Recombinant Rabbit mAb
Catalog: BF3694
Description: Rabbit monoclonal antibody to S100 A1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 11 kDa(Observed); 11kD(Calculated).
Uniprot: P23297

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:100-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23141]
Specificity:
S100 A1 Recombinant Rabbit mAb detects endogenous levels of S100 A1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bpb; NEF; Protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100 alpha; S100 Alpha Chain; S100; S100 Beta Chain; S100 Calcium Binding Protein A1; S100 Calcium Binding Protein B; S100 Calcium Binding Protein Beta Neural; S100 calcium-binding protein A1; S100 protein alpha polypeptide; S100A; s100a1; S10A1_HUMAN;

Immunogens

Immunogen:

A synthetic peptide from human S100 A1

Uniprot:
Gene(ID):
Expression:
P23297 S10A1_HUMAN:

Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.

Description:
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and,or nucleus of a wide range of cells,and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release,inhibition of microtubule assembly,and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies.
Sequence:
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Research Backgrounds

Function:

Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.

Family&Domains:

Belongs to the S-100 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.