CD74 Recombinant Rabbit mAb - #BF3702

Copy Info
Product: CD74 Recombinant Rabbit mAb
Catalog: BF3702
Description: Rabbit monoclonal antibody to CD74
Application: IHC
Reactivity: Human
Mol.Wt.: 34 kDa(Observed); 34kD(Calculated).
Uniprot: P04233

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
IHC 1:200-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23149]
Specificity:
CD74 Recombinant Rabbit mAb detects endogenous levels of CD74.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD 74; CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 antigen; CD74 molecule; CD74 molecule, major histocompatibility complex, class II invariant chain; CLIP; DHLAG; Gamma chain of class II antigens; HG2A_HUMAN; HLA class II histocompatibility antigen gamma chain; HLA DR antigens associated invariant chain; HLA DR gamma; HLA-DR antigens-associated invariant chain; HLA-DR-gamma; HLADG; HLADR antigens associated invariant chain; Ia antigen associated invariant chain; Ia antigen-associated invariant chain; Ia associated invariant chain; Ia gamma; Ii; Invariant polypeptide of major histocompatibility complex class II antigen associated; la-gamma; Major histocompatibility complex class II invariant chain; MHC HLA DR gamma chain; MHC HLA-DR gamma chain; p33; p35; Protein 41;

Immunogens

Immunogen:

A synthetic peptide from human CD74

Uniprot:

P04233(HG2A_HUMAN) >>Visit HPA database.

Gene(ID):
CD74(972)
Description:
The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which,when bound to the encoded protein,initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Sequence:
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Research Backgrounds

Function:

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.

Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.

PTMs:

N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus>trans-Golgi network. Endosome. Lysosome.
Note: Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.