GHRL Recombinant Rabbit mAb - #BF3760

WB 1:1000, IHC 1:200-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Human,Mouse

Monoclonal [ReFirm23207]

GHRL Recombinant Rabbit mAb detects endogenous levels of GHRL.

Unconjugated.

Affinity-chromatography.

Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Q9UBU3(GHRL_HUMAN) >>Visit HPA database.

Q9UBU3 GHRL_HUMAN:

Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.

This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides,ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty,whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities,including hunger,reward perception via the mesolimbic pathway,gastric acid secretion,gastrointestinal motility,and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake,but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin,including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition,antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression.

•    Q9UBU3 GHRL_HUMAN:
• Protein BLAST With
• NCBI/
• ExPASy/
• Uniprot

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK