GDF15 Recombinant Rabbit mAb - #BF3797

(2)   Copy Info
Product: GDF15 Recombinant Rabbit mAb
Catalog: BF3797
Description: Rabbit monoclonal antibody to GDF15
Application: WB IHC
Reactivity: Human
Mol.Wt.: 35,13 kDa(Observed); 34kD(Calculated).
Uniprot: Q99988

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23244]
Specificity:
GDF15 Recombinant Rabbit mAb detects endogenous levels of GDF15.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GDF 15; GDF-15; Gdf15; GDF15_HUMAN; Growth differentiation factor 15; Growth/differentiation factor 15; Macrophage inhibitory cytokine 1; MIC 1; Mic-1; MIC1; NAG 1; NAG-1; NAG1; NRG 1; NRG-1; NRG1; NSAID (nonsteroidal anti inflammatory drug) activated protein 1; NSAID; NSAID regulated protein 1; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; PDF; PLAB; Placental bone morphogenetic protein; Placental bone morphogenic protein; Placental TGF beta; Placental TGF-beta; Prostate differentiation factor; PTGF beta; PTGFB;

Immunogens

Immunogen:

A synthetic peptide from human GDF15

Uniprot:

Q99988(GDF15_HUMAN) >>Visit HPA database.

Gene(ID):
GDF15(9518)
Expression:
Q99988 GDF15_HUMAN:

Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney (PubMed:9348093). Detected in plasma (at protein level) (PubMed:28572090, PubMed:29046435).

Description:
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types,acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia,inflammation,acute injury and oxidative stress.
Sequence:
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Research Backgrounds

Function:

Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which contitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling (By similarity).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney. Detected in plasma (at protein level).

Family&Domains:

Belongs to the TGF-beta family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.