Product: S100A11 Recombinant Rabbit mAb
Catalog: BF3827
Description: Rabbit monoclonal antibody to S100A11
Application: IHC IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 12 kDa(Observed); 12kD(Calculated).
Uniprot: P31949

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
IHC 1:200-1:500, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Rat
Clonality:
Monoclonal [ReFirm23274]
Specificity:
S100A11 Recombinant Rabbit mAb detects endogenous levels of S100A11.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Calgizzarin; Epididymis secretory protein Li 43; HEL S 43; Metastatic lymph node gene 70 protein; MLN 70; MLN70; Protein S100 A11; Protein S100-A11, N-terminally processed; Protein S100-C; Protein S100A11; Protein S100C; S100 A11; S100 calcium binding protein A11; S100 calcium-binding protein A11 (calgizzarin); S100 calcium-binding protein A11; S100a11; S100C; S10AB_HUMAN;

Immunogens

Immunogen:

A synthetic peptide from human S100A11

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and,or nucleus of a wide range of cells,and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility,invasion,and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Sequence:
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Research Backgrounds

Function:

Facilitates the differentiation and the cornification of keratinocytes.

PTMs:

Phosphorylation at Thr-10 by PRKCA significantly suppresses homodimerization and promotes association with NCL/nucleolin which induces nuclear translocation.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the S-100 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.