Product: KLK3 Recombinant Rabbit mAb
Catalog: BF3860
Description: Rabbit monoclonal antibody to KLK3
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 29 kDa(Observed); 29kD(Calculated).
Uniprot: P07288

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Monoclonal [ReFirm23307]
Specificity:
KLK3 Recombinant Rabbit mAb detects endogenous levels of KLK3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

antigen, prostate-specific; APS; Gamma seminoprotein; Gamma-seminoprotein; hK3; Kallikrein 3; Kallikrein related peptidase 3; Kallikrein-3; KLK 3; KLK2A1; Klk3; KLK3_HUMAN; P-30 antigen; P30 antigen; Prostate-specific antigen; Psa; Semenogelase; Seminin;

Immunogens

Immunogen:

A synthetic peptide from human KLK3

Uniprot:
Gene(ID):
Description:
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein,a protease which is synthesized in the epithelial cells of the prostate gland,and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum,presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein,called PSA in the clinical setting,is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.
Sequence:
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Research Backgrounds

Function:

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase S1 family. Kallikrein subfamily.

Research Fields

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.