MBL2 Recombinant Rabbit mAb - #BF3863

(3)   Copy Info
Product: MBL2 Recombinant Rabbit mAb
Catalog: BF3863
Description: Rabbit monoclonal antibody to MBL2
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 26 kDa(Observed); 26kD(Calculated).
Uniprot: P11226

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm23310]
Specificity:
MBL2 Recombinant Rabbit mAb detects endogenous levels of MBL2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

COLEC 1; COLEC1; Collectin-1; HSMBPC; Lectin, mannose-binding, soluble, 2; Mannan binding lectin; Mannan binding protein; Mannan-binding protein; Mannose binding lectin (protein C) 2 soluble; Mannose binding lectin (protein C) 2, soluble (opsonic defect); Mannose binding lectin (protein C) 2, soluble; Mannose binding lectin 2 soluble; Mannose binding lectin 2, soluble (opsonic defect); Mannose binding lectin; Mannose binding lectin protein C2 soluble opsonic defect; Mannose binding protein; Mannose binding protein C; Mannose binding protein C precursor; Mannose binding protein, serum; Mannose-binding lectin; Mannose-binding protein C; MBL 2; MBL; MBL2; MBL2_HUMAN; MBL2D; MBP 1; MBP; MBP C; MBP-C; MBP1; MBPB; MBPC; MBPD; MGC116832; MGC116833; Opsonic defect; protein C; Soluble mannose binding lectin;

Immunogens

Immunogen:

A synthetic peptide from human MBL2

Uniprot:

P11226(MBL2_HUMAN) >>Visit HPA database.

Gene(ID):
MBL2(4153)
Expression:
P11226 MBL2_HUMAN:

Plasma protein produced mainly in the liver.

Description:
This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms,and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Sequence:
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Research Backgrounds

Function:

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Plasma protein produced mainly in the liver.

Family&Domains:

The coiled-coil domain mediates trimerization.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.

· Organismal Systems > Immune system > Complement and coagulation cascades.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.