Product: Peroxiredoxin 5 Recombinant Rabbit mAb
Catalog: BF3883
Description: Rabbit monoclonal antibody to Peroxiredoxin 5
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 17 kDa(Observed); 22kD(Calculated).
Uniprot: P30044

View similar products>>

Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:100-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23330]
Specificity:
Peroxiredoxin 5 Recombinant Rabbit mAb detects endogenous levels of Peroxiredoxin 5.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ACR1; Alu co repressor 1; Alu corepressor 1; Antioxidant enzyme B166; AOEB166; B166; epididymis secretory protein Li 55; HEL-S-55; Liver tissue 2D-page spot 71B; mitochondrial; Peroxiredoxin 5, mitochondrial; Peroxiredoxin V; Peroxiredoxin-5; Peroxisomal antioxidant enzyme; PLP; PMP20; PRDX 5; PRDX5; PRDX5_HUMAN; PRDX6; Prx-V; PRXV; SBBI10; Thioredoxin peroxidase PMP20; Thioredoxin reductase; TPx type VI;

Immunogens

Immunogen:

A synthetic peptide from human Peroxiredoxin 5

Uniprot:
Gene(ID):
Expression:
P30044 PRDX5_HUMAN:

Widely expressed.

Description:
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes,which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome,cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene.
Sequence:
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Research Backgrounds

Function:

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events.

Subcellular Location:

Mitochondrion.

Cytoplasm. Peroxisome matrix.
Note: Imported into peroxisomes via peroxisomal targeting signal 1 receptor PEX5.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed.

Family&Domains:

Belongs to the peroxiredoxin family. Prx5 subfamily.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.