AGR2 Recombinant Rabbit mAb - #BF3900

(1)   Copy Info
Product: AGR2 Recombinant Rabbit mAb
Catalog: BF3900
Description: Rabbit monoclonal antibody to AGR2
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 18 kDa(Observed); 20kD(Calculated).
Uniprot: O95994

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:200-1:500, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23347]
Specificity:
AGR2 Recombinant Rabbit mAb detects endogenous levels of AGR2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AG 2; AG 2 protein; AG-2; AG2; AG2 protein; AGR 2; AGR2; AGR2_HUMAN; Anterior gradient 2 homolog (Xenopus laevis); anterior gradient 2 homolog; Anterior gradient 2, protein disulphide isomerase family member; Anterior gradient 2, Xenopus, homolog of; Anterior gradient homolog 2; Anterior gradient protein 2 homolog; Epididymis secretory protein Li 116; GOB 4; GOB4; HAG 2; hAG-2; hAG2; HAG2/R; HEL S 116; HPC 8; hPC8; PDIA17; Protein disulfide isomerase family A member 17; secreted cement gland homolog; Secreted cement gland protein XAG 2 homolog; Secreted cement gland protein XAG-2 homolog; Secreted cement gland protein XAG2 homolog; XAG 2; XAG2;

Immunogens

Immunogen:

A synthetic peptide from human AGR2

Uniprot:

O95994(AGR2_HUMAN) >>Visit HPA database.

Gene(ID):
AGR2(10551)
Expression:
O95994 AGR2_HUMAN:

Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis, placenta, thyroid gland and in estrogen receptor (ER)-positive breast cancer cell lines.

Description:
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence,a catalytically active thioredoxin domain,and a C-terminal ER-retention sequence. This protein plays a role in cell migration,cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone,it plays a role in the folding,trafficking,and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression.
Sequence:
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Research Backgrounds

Function:

Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells (By similarity). Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.

Subcellular Location:

Secreted. Endoplasmic reticulum.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis, placenta, thyroid gland and in estrogen receptor (ER)-positive breast cancer cell lines.

Family&Domains:

Belongs to the AGR family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.