Product: Caspase 6 Recombinant Rabbit mAb
Catalog: BF4087
Description: Rabbit monoclonal antibody to Caspase 6
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 11kDa(cleavage),33 kDa(Observed); 33kD(Calculated).
Uniprot: P55212

View similar products>>

Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:100-1:200, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23534]
Specificity:
Caspase 6 Recombinant Rabbit mAb detects endogenous levels of Caspase 6.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptotic protease Mch-2; Apoptotic protease MCH2; CASP-6; CASP6; CASP6_HUMAN; Caspase 6; Caspase 6 apoptosis related cysteine protease; Caspase 6, apoptosis related cysteine peptidase; Caspase-6 subunit p11; Mch2; OTTHUMP00000162742; OTTHUMP00000162743;

Immunogens

Immunogen:

A synthetic peptide from human Caspase 6

Uniprot:
Gene(ID):
Description:
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits,large and small,that dimerize to form the active enzyme. This protein is processed by caspases 7,8 and 10,and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.
Sequence:
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN

Research Backgrounds

Function:

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves poly(ADP-ribose) polymerase in vitro, as well as lamins. Overexpression promotes programmed cell death.

PTMs:

Cleavages by caspase-3, caspase-8 or -10 generate the two active subunits.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.