CEBPG Antibody - #DF3210
| Product: | CEBPG Antibody |
| Catalog: | DF3210 |
| Description: | Rabbit polyclonal antibody to CEBPG |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 22 KD; 16kD(Calculated). |
| Uniprot: | P53567 |
| RRID: | AB_2835590 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3210, RRID:AB_2835590.
Fold/Unfold
C/EBP gamma; CCAAT/enhancer binding protein (C/EBP) gamma; CCAAT/enhancer binding protein gamma; CCAAT/enhancer-binding protein gamma; CEBPG; CEBPG_HUMAN; GPE1BP; IG/EBP 1; IG/EBP1;
Immunogens
- P53567 CEBPG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P53567 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R60 | Methylation | Uniprot | |
| S62 | Phosphorylation | Uniprot | |
| K86 | Ubiquitination | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| K113 | Ubiquitination | Uniprot | |
| K119 | Ubiquitination | Uniprot | |
| T142 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.
Nucleus.
Binds DNA as a dimer and can form stable heterodimers with CEBPA and CEBPB. Interacts with ZNF638; this interaction increases transcriptional activation.
Belongs to the bZIP family. C/EBP subfamily.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.