Product: LEG7 Recombinant Rabbit mAb
Catalog: BF4149
Description: Rabbit monoclonal antibody to LEG7
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 15 kDa(Observed); 15kD(Calculated).
Uniprot: P47929

View similar products>>

Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:500-1:2000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23596]
Specificity:
LEG7 Recombinant Rabbit mAb detects endogenous levels of LEG7.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Gal-7; GAL7; Galectin 7B; Galectin-7; HKL-14; Human keratinocyte lectin 14; Keratinocyte lectin 14; Lectin galactoside binding soluble 7; Lectin, galactoside binding, soluble, 7B; LEG7_HUMAN; LGALS7; LGALS7A; LGALS7B; P53 induced protein 1; p53-induced gene 1 protein; Pi7; PIG1; TP53I1;

Immunogens

Immunogen:

A synthetic peptide from human LEG7

Uniprot:
Gene(ID):
Expression:
P47929 LEG7_HUMAN:

Mainly expressed in stratified squamous epithelium.

Description:
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to,but on the opposite strand on chromosome 19.
Sequence:
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Research Backgrounds

Function:

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Subcellular Location:

Cytoplasm. Nucleus. Secreted.
Note: May be secreted by a non-classical secretory pathway.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Mainly expressed in stratified squamous epithelium.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.