PTTG Antibody - #DF3213
| Product: | PTTG Antibody |
| Catalog: | DF3213 |
| Description: | Rabbit polyclonal antibody to PTTG |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 20 KD; 20kD(Calculated). |
| Uniprot: | P53801 |
| RRID: | AB_2835593 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3213, RRID:AB_2835593.
Fold/Unfold
1810010L20Rik; AI314311; AU018448; C21orf1; C21orf3; C79540; chromosome 21 open reading frame 1; MGC36923; PBF; Pituitary tumor transforming 1 interacting protein; Pituitary tumor transforming gene 1 protein interacting protein; Pituitary tumor transforming gene protein binding factor; Pituitary tumor-transforming gene 1 protein-interacting protein; Pituitary tumor-transforming gene protein-binding factor; PTTG binding factor; PTTG-binding factor; PTTG_HUMAN; Pttg1ip; Putative surface glycoprotein C21orf1 precursor;
Immunogens
A synthesized peptide derived from human PTTG, corresponding to a region within C-terminal amino acids.
- P53801 PTTG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May facilitate PTTG1 nuclear translocation.
Membrane>Single-pass type I membrane protein. Cytoplasm. Nucleus.
Note: According to PubMed:10781616, it is found in the cytoplasm and the nucleus.
Ubiquitous.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.