Product: RBM3 Recombinant Rabbit mAb
Catalog: BF4187
Description: Rabbit monoclonal antibody to RBM3
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 17 kDa(Observed); 17kD(Calculated).
Uniprot: P98179

View similar products>>

Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:100-1:200, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23634]
Specificity:
RBM3 Recombinant Rabbit mAb detects endogenous levels of RBM3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2600016C11Rik; IS1 RNPL; MGC105811; MGC118410; OTTHUMP00000025800; OTTHUMP00000025802; OTTMUSP00000019634; OTTMUSP00000019635; OTTMUSP00000019636; Putative RNA binding protein 3; Putative RNA-binding protein 3; Rbm3; RBM3_HUMAN; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; RNA-binding motif protein 3; RNA-binding protein 3; RNPL; RP23-27I6.7;

Immunogens

Immunogen:

A synthetic peptide from human RBM3

Uniprot:
Gene(ID):
Description:
This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria.
Sequence:
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

Research Backgrounds

Function:

Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation (By similarity).

PTMs:

Arg-105 is dimethylated, probably to asymmetric dimethylarginine.

Phosphorylated.

Subcellular Location:

Nucleus. Cytoplasm. Cell projection>Dendrite.
Note: Localizes in mRNA granules in dentrites.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.