S100A6 Recombinant Rabbit mAb - #BF4232

Copy Info
Product: S100A6 Recombinant Rabbit mAb
Catalog: BF4232
Description: Rabbit monoclonal antibody to S100A6
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 10 kDa(Observed); 10kD(Calculated).
Uniprot: P06703

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23682]
Specificity:
S100A6 Recombinant Rabbit mAb detects endogenous levels of S100A6.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2A9; 5B10; CABP; CACY; Calcyclin; Growth factor inducible protein 2A9; Growth factor-inducible protein 2A9; MLN 4; MLN4; OTTHUMP00000015472; OTTHUMP00000015473; PRA; PRAGrowth factor inducible protein 2A9; Prolactin receptor associated protein; Prolactin receptor-associated protein; Protein S100 A6; Protein S100-A6; S100 A6; S100 calcium binding protein A6 (calcyclin); S100 calcium binding protein A6; S100 calcium-binding protein A6; S100A6; S10A6_HUMAN;

Immunogens

Immunogen:

A synthetic peptide from human S100A6

Uniprot:

P06703(S10A6_HUMAN) >>Visit HPA database.

Gene(ID):
S100A6(6277)
Description:
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and,or nucleus of a wide range of cells,and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release,stimulation of prolactin secretion,and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.
Sequence:
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Research Backgrounds

Function:

May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

PTMs:

The N-terminus is blocked.

Subcellular Location:

Nucleus envelope. Cytoplasm. Cell membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the S-100 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.