HMGA2 Recombinant Rabbit mAb - #BF4238

Copy Info
Product: HMGA2 Recombinant Rabbit mAb
Catalog: BF4238
Description: Rabbit monoclonal antibody to HMGA2
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 18kd(Observed); 12kD(Calculated).
Uniprot: P52926

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:200-1:1000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23688]
Specificity:
HMGA2 Recombinant Rabbit mAb detects endogenous levels of HMGA2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HMGA 2; BABL; High mobility group (nonhistone chromosomal) protein isoform I C; High mobility group (nonhistone chromosomal) protein isoform IC; High Mobility Group AT hook 2; High Mobility Group AT hook protein 2; High mobility group AT-hook protein 2; High mobility group protein HMGI C; High mobility group protein HMGI-C; High mobility group protein HMGIC; High mobility group protein I, isoform C; HMGA2; HMGA2_HUMAN; HMGI C; HMGIC; LIPO; Non histone chromosomal architectural protein HMGI C; Non histone chromosomal architectural protein HMGIC; Pygmy; STQTL9;

Immunogens

Immunogen:

A synthetic peptide from human HMGA2

Uniprot:

P52926(HMGA2_HUMAN) >>Visit HPA database.

Gene(ID):
HMGA2(8091)
Description:
This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion,amplification,and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants,encoding different isoforms,have been characterized.
Sequence:
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Research Backgrounds

Function:

Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation (By similarity).

PTMs:

Regulated by cell cycle-dependent phosphorylation which alters its DNA binding affinity. Phosphorylated by NEK2 (By similarity).

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the HMGA family.

Research Fields

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.