PITX1 Antibody - #DF3224
| Product: | PITX1 Antibody |
| Catalog: | DF3224 |
| Description: | Rabbit polyclonal antibody to PITX1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 34 KD; 34kD(Calculated). |
| Uniprot: | P78337 |
| RRID: | AB_2835604 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3224, RRID:AB_2835604.
Fold/Unfold
BFT; CCF; Hindlimb expressed homeobox protein backfoot; Hindlimb-expressed homeobox protein backfoot; Homeobox protein PITX1; LBNBG; Paired like homeodomain 1; Paired like homeodomain transcription factor 1; Paired-like homeodomain transcription factor 1; Pituitary homeo box 1; Pituitary homeobox 1; Pituitary otx related factor; Pitx1; PITX1_HUMAN; POTX; PTX1;
Immunogens
A synthesized peptide derived from human PITX1, corresponding to a region within the internal amino acids.
- P78337 PITX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.
Nucleus.
Belongs to the paired homeobox family. Bicoid subfamily.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.