CCL17 Recombinant Rabbit mAb - #BF4322

Copy Info
Product: CCL17 Recombinant Rabbit mAb
Catalog: BF4322
Description: Rabbit monoclonal antibody to CCL17
Application: IHC
Reactivity: Human
Mol.Wt.: 11 kDa(Observed); 11kD(Calculated).
Uniprot: Q92583

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
IHC 1:200-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23772]
Specificity:
CCL17 Recombinant Rabbit mAb detects endogenous levels of CCL17.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

A-152E5.3; A152E53; ABCD 2; ABCD2; C-C motif chemokine 17; CC chemokine TARC; CCL17; CCL17_HUMAN; Chemokine CC Motif Ligand 17; MGC138271; MGC138273; SCYA17; Small Inducible Cytokine A17; Small Inducible Cytokine A17 Precursor; Small Inducible Cytokine Subfamily A (Cys Cys); Small Inducible Cytokine Subfamily A (Cys Cys) Member 17; Small-inducible cytokine A17; T Cell Directed CC Chemokine; Thymus and activation regulated chemokine; Thymus and activation-regulated chemokine;

Immunogens

Immunogen:

A synthetic peptide from human CCL17

Uniprot:

Q92583(CCL17_HUMAN) >>Visit HPA database.

Gene(ID):
CCL17(6361)
Expression:
Q92583 CCL17_HUMAN:

Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.

Description:
This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes,but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
Sequence:
MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Research Backgrounds

Function:

Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.