CLPP Recombinant Rabbit mAb - #BF4325

Copy Info
Product: CLPP Recombinant Rabbit mAb
Catalog: BF4325
Description: Rabbit monoclonal antibody to CLPP
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 30 kDa(Observed); 30kD(Calculated).
Uniprot: Q16740

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, IHC 1:50
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23775]
Specificity:
CLPP Recombinant Rabbit mAb detects endogenous levels of CLPP.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ATP dependent protease ClpAP (E coli) proteolytic subunit; ATP dependent protease ClpAP proteolytic subunit; ATP dependent protease ClpAP proteolytic subunit human; ATP dependent proteolytic subunit homolog (E coli); ATP dependent proteolytic subunit homolog; Caseinolytic peptidase ATP dependent proteolytic subunit homolog; Caseinolytic protease ATP dependent proteolytic subunit E coli; clpP; ClpP caseinolytic peptidase ATP dependent proteolytic subunit; ClpP caseinolytic peptidase ATP dependent proteolytic subunit homolog; CLPP_HUMAN; Endopeptidase Clp; mitochondrial; Putative ATP dependent Clp protease proteolytic subunit mitochondrial; Putative ATP dependent Clp protease proteolytic subunit; Putative ATP-dependent Clp protease proteolytic subunit;

Immunogens

Immunogen:

A synthetic peptide from human CLPP

Uniprot:

Q16740(CLPP_HUMAN) >>Visit HPA database.

Gene(ID):
CLPP(8192)
Expression:
Q16740 CLPP_HUMAN:

Detected in liver (at protein level). Predominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.

Description:
The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.
Sequence:
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Research Backgrounds

Function:

Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. Cleaves PINK1 in the mitochondrion.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in liver (at protein level). Predominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.

Family&Domains:

Belongs to the peptidase S14 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.