FBXO32 Recombinant Rabbit mAb - #BF4330

Copy Info
Product: FBXO32 Recombinant Rabbit mAb
Catalog: BF4330
Description: Rabbit monoclonal antibody to FBXO32
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 42 kDa(Observed); 42kD(Calculated).
Uniprot: Q969P5

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23780]
Specificity:
FBXO32 Recombinant Rabbit mAb detects endogenous levels of FBXO32.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4833442G10Rik; AI430017; Atrogin 1; Atrogin-1; ATROGIN1; Atrophy gene 1; F box only protein 32; F-box only protein 32; F-box protein 32; FBX32_HUMAN; fbxo25; FBXO32; FLJ32424; MAFbx; MGC108443; MGC137646; MGC33610; Muscle atrophy F box; Muscle atrophy F box protein; Muscle atrophy F-box protein;

Immunogens

Immunogen:

A synthetic peptide from human FBXO32

Uniprot:

Q969P5(FBX32_HUMAN) >>Visit HPA database.

Gene(ID):
FBXO32(114907)
Expression:
Q969P5 FBX32_HUMAN:

Specifically expressed in cardiac and skeletal muscle.

Description:
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif,the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box),which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains,Fbls containing leucine-rich repeats,and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy,whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Sequence:
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Research Backgrounds

Function:

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Shuttles between cytoplasm and the nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Specifically expressed in cardiac and skeletal muscle.

Research Fields

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.