CD82 Recombinant Rabbit mAb - #BF4347

Copy Info
Product: CD82 Recombinant Rabbit mAb
Catalog: BF4347
Description: Rabbit monoclonal antibody to CD82
Application: WB
Reactivity: Human
Mol.Wt.: 30-60 kDa(Observed); 30kD(Calculated).
Uniprot: P27701

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23797]
Specificity:
CD82 Recombinant Rabbit mAb detects endogenous levels of CD82.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4F9; Antigen detected by monoclonal and antibody IA4; C33; C33 antigen; CD 82; CD82; CD82 antigen; CD82 molecule; CD82_HUMAN; GR 15; GR15; IA 4; IA4; Inducible membrane protein; Inducible membrane protein R2; KAI 1; KAI1; Kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); Kangai 1; Kangai1; Leukocyte surface antigen R2; Metastasis suppressor Kangai 1; Metastasis suppressor Kangai-1; Metastasis suppressor Kangai1; Prostate cancer antimetastasis gene KAI1; R2; R2 leukocyte antigen; SAR 2; SAR2; ST 6; ST6; Suppression of tumorigenicity 6; Suppression of tumorigenicity 6 prostate; Suppressor of tumorigenicity 6; Suppressor of tumorigenicity 6 protein; Tetraspanin 27; Tetraspanin-27; Tetraspanin27; Tspan 27; Tspan-27; Tspan27;

Immunogens

Immunogen:

A synthetic peptide from human CD82

Uniprot:

P27701(CD82_HUMAN) >>Visit HPA database.

Gene(ID):
CD82(3732)
Expression:
P27701 CD82_HUMAN:

Lymphoid specific.

Description:
This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated,and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Sequence:
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY

Research Backgrounds

Function:

Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Lymphoid specific.

Family&Domains:

Belongs to the tetraspanin (TM4SF) family.

Research Fields

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.