FKBP1A Recombinant Rabbit mAb - #BF4367

Copy Info
Product: FKBP1A Recombinant Rabbit mAb
Catalog: BF4367
Description: Rabbit monoclonal antibody to FKBP1A
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 12 kDa(Observed); 12kD(Calculated).
Uniprot: P62942

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23817]
Specificity:
FKBP1A Recombinant Rabbit mAb detects endogenous levels of FKBP1A.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

12 kDa FK506-binding protein; 12 kDa FKBP; Calstabin 1; FK506 binding protein 1; FK506 binding protein 12; FK506 binding protein 1A (12kD); FK506 binding protein 1A 12kDa; FK506 binding protein 1A; FK506 binding protein T cell 12 kD; FK506 binding protein, T cell, 12 kD; FK506 binding protein12; FK506-binding protein 1A; FKB1A_HUMAN; FKBP 12; FKBP 1A; FKBP-12; FKBP-1A; FKBP1; FKBP12; FKBP12 Exip3; FKBP12C; fkbp1a; Immunophilin FKBP12; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIase; PPIase FKBP1A; Protein kinase C inhibitor 2; Rotamase;

Immunogens

Immunogen:

A synthetic peptide from human FKBP1A

Uniprot:

P62942(FKB1A_HUMAN) >>Visit HPA database.

Gene(ID):
FKBP1A(2280)
Description:
The protein encoded by this gene is a member of the immunophilin protein family,which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels,and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse,deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants,encoding the same protein,have been identified. The human genome contains five pseudogenes related to this gene,at least one of which is transcribed.
Sequence:
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Research Backgrounds

Function:

Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Subcellular Location:

Cytoplasm>Cytosol. Sarcoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the FKBP-type PPIase family. FKBP1 subfamily.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.