CDKL1 Antibody - #DF3233
Product: | CDKL1 Antibody |
Catalog: | DF3233 |
Description: | Rabbit polyclonal antibody to CDKL1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Dog |
Mol.Wt.: | 42 KD; 42kD(Calculated). |
Uniprot: | Q00532 |
RRID: | AB_2835613 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3233, RRID:AB_2835613.
Fold/Unfold
CDC 2 related kinase 1; CDC 2 related kinase; CDC2 related kinase 1; CDC2 related kinase; CDK L1; CDKL 1; cdkl1; CDKL1_HUMAN; Cyclin dependent kinase like 1; cyclin-dependent kinase-like 1 (CDC2-related kinase); Cyclin-dependent kinase-like 1; EC 2.7.11.22; KKIALRE; p42; Protein kinase p42 KKIALRE; Serine/threonine protein kinase KKIALRE; Serine/threonine-protein kinase KKIALRE;
Immunogens
- Q00532 CDKL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q00532 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K34 | Ubiquitination | Uniprot |
Research Backgrounds
Cytoplasm. Nucleus.
Highly expressed in kidney, and to a lower extent in ovary.
The [NKR]KIAxRE motif seems to be a cyclin-binding region.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.