GSTA4 Recombinant Rabbit mAb - #BF4548

WB 1:1000-1:5000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Human, Rat

Monoclonal [ReFirm23998]

GSTA4 Recombinant Rabbit mAb detects endogenous levels of GSTA4.

Unconjugated.

Affinity-chromatography.

Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

O15217(GSTA4_HUMAN) >>Visit HPA database.

O15217 GSTA4_HUMAN:

Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic,carcinogenic,and pharmacologically active electrophilic compounds. At present,eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha,kappa,mu,omega,pi,sigma,theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes,which are located in a cluster on chromosome 6,are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease,Alzheimer's disease,cataract formation,and atherosclerosis.

•    O15217 GSTA4_HUMAN:
• Protein BLAST With
• NCBI/
• ExPASy/
• Uniprot

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP