TRIM29 Recombinant Rabbit mAb - #BF4559

Copy Info
Product: TRIM29 Recombinant Rabbit mAb
Catalog: BF4559
Description: Rabbit monoclonal antibody to TRIM29
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 66 kDa(Observed); 66kD(Calculated).
Uniprot: Q14134

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm24009]
Specificity:
TRIM29 Recombinant Rabbit mAb detects endogenous levels of TRIM29.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ataxia telangiectasia group D associated protein; Ataxia telangiectasia group D-associated protein; ATDC; FLJ36085; TRI29_HUMAN; TRIM 29; TRIM29; Tripartite motif containing 29; Tripartite motif containing protein 29; Tripartite motif protein 29; Tripartite motif protein TRIM29; Tripartite motif-containing protein 29;

Immunogens

Immunogen:

A synthetic peptide from human TRIM29

Uniprot:

Q14134(TRI29_HUMAN) >>Visit HPA database.

Gene(ID):
TRIM29(23650)
Expression:
Q14134 TRI29_HUMAN:

Expressed in placenta, prostate and thymus.

Description:
The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus,it may act as a transcriptional regulatory factor involved in carcinogenesis and,or differentiation. It may also function in the suppression of radiosensitivity since it is associated with ataxia telangiectasia phenotype.
Sequence:
MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Research Backgrounds

Function:

Plays a crucial role in the regulation of macrophage activation in response to viral or bacterial infections within the respiratory tract. Mechanistically, TRIM29 interacts with IKBKG/NEMO in the lysosome where it induces its 'Lys-48' ubiquitination and subsequent degradation. In turn, the expression of type I interferons and the production of proinflammatory cytokines are inhibited. Additionally, induces the 'Lys-48' ubiquitination of STING1 in a similar way, leading to its degradation.

PTMs:

Constitutively phosphorylated by PKC on serine/threonine in A431 cells.

Subcellular Location:

Cytoplasm. Lysosome.
Note: Colocalizes with intermediate filaments.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in placenta, prostate and thymus.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.