Proteasome 20S LMP2 Recombinant Rabbit mAb - #BF4606

Copy Info
Product: Proteasome 20S LMP2 Recombinant Rabbit mAb
Catalog: BF4606
Description: Rabbit monoclonal antibody to Proteasome 20S LMP2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 21,23 kDa(Observed); 23kD(Calculated).
Uniprot: P28065

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:200-1:2000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm24056]
Specificity:
Proteasome 20S LMP2 Recombinant Rabbit mAb detects endogenous levels of Proteasome 20S LMP2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta1i; Large multifunctional peptidase 2; Large multifunctional protease 2; LMP 2; LMP2; Low molecular mass protein 2; Macropain chain 7; MGC70470; Multicatalytic endopeptidase complex chain 7; OTTHUMP00000062982; Proteasome (prosome macropain) subunit beta type 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); Proteasome beta 9 subunit; Proteasome catalytic subunit 1i; Proteasome chain 7; Proteasome related gene 2; Proteasome subunit beta 6i; Proteasome subunit beta type 9; Proteasome subunit beta type-9; Proteasome subunit beta-1i; PSB9_HUMAN; PSMB 9; PSMB6i; PSMB9; Really interesting new gene 12 protein; RING 12; RING12; RING12 protein;

Immunogens

Immunogen:

A synthetic peptide from human Proteasome 20S LMP2

Uniprot:

P28065(PSB9_HUMAN) >>Visit HPA database.

Gene(ID):
PSMB9(5698)
Description:
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits,2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP,ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome,the immunoproteasome,is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family,also known as the T1B family,that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.
Sequence:
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Research Backgrounds

Function:

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.

PTMs:

Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase T1B family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.