TIA1 Recombinant Rabbit mAb - #BF4633

(1)   Copy Info
Product: TIA1 Recombinant Rabbit mAb
Catalog: BF4633
Description: Rabbit monoclonal antibody to TIA1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 43 kDa(Observed); 43kD(Calculated).
Uniprot: P31483

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, IHC 1:200-1:1000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Monoclonal [ReFirm24083]
Specificity:
TIA1 Recombinant Rabbit mAb detects endogenous levels of TIA1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cytotoxic granule associated RNA binding protein 1; Cytotoxic granule associated RNA binding protein; mTIA-1; Nucleolysin TIA 1 isoform p40; Nucleolysin TIA-1 isoform p40; Nucleolysin TIA1 isoform p40; p40 TIA 1; p40-TIA-1 (containing p15-TIA-1); p40-TIA-1; RNA binding protein TIA 1; RNA binding protein TIA1; RNA-binding protein TIA-1; T-cell-restricted intracellular antigen-1; TIA 1; TIA 1 cytotoxic granule associated RNA binding protein; Tia; TIA-1; TIA1; TIA1 cytotoxic granule associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein like 1; TIA1 protein; TIA1_HUMAN; TIAL1; TIAR; WDM;

Immunogens

Immunogen:

A synthetic peptide from human TIA1

Uniprot:

P31483(TIA1_HUMAN) >>Visit HPA database.

Gene(ID):
TIA1(7072)
Description:
The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene.
Sequence:
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ

Research Backgrounds

Function:

Involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis.

Subcellular Location:

Cytoplasm>Stress granule. Nucleus.
Note: Accumulates in cytoplasmic stress granules (SG) following cellular damage.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.