TUSC5 Antibody - #DF3345
Product: | TUSC5 Antibody |
Catalog: | DF3345 |
Description: | Rabbit polyclonal antibody to TUSC5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 22 KD; 19kD(Calculated). |
Uniprot: | Q8IXB3 |
RRID: | AB_2835712 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3345, RRID:AB_2835712.
Fold/Unfold
Dispanin subfamily B member 1; DSPB1; Interferon-induced transmembrane domain-containing protein D3; LOST1; Protein located at seventeen p thirteen point three 1; Protein located at seventeen-p-thirteen point three 1; Tumor suppressor candidate 5; Tusc5; TUSC5_HUMAN;
Immunogens
Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the corresponding locus (PubMed:12660825). Expressed in adipose tissue (PubMed:26629404).
- Q8IXB3 TARG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
PTMs - Q8IXB3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S11 | Phosphorylation | Uniprot | |
S48 | Phosphorylation | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S66 | Phosphorylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
S87 | Phosphorylation | Uniprot | |
S88 | Phosphorylation | Uniprot | |
T169 | Phosphorylation | Uniprot |
Research Backgrounds
Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation.
Cell membrane>Multi-pass membrane protein. Endomembrane system>Multi-pass membrane protein. Cytoplasm>Perinuclear region.
Note: Shifts from low-density microsome vesicles to the cell membrane upon insulin stimulation.
Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the corresponding locus. Expressed in adipose tissue.
Interacts with SLC2A4; the interaction is required for proper SLC2A4 reacycling after insulin stimulation.
Belongs to the CD225/Dispanin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.