PBOV1 Antibody - #DF3426
| Product: | PBOV1 Antibody |
| Catalog: | DF3426 |
| Description: | Rabbit polyclonal antibody to PBOV1 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 19 KD; 16kD(Calculated). |
| Uniprot: | Q9GZY1 |
| RRID: | AB_2835726 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3426, RRID:AB_2835726.
Fold/Unfold
PBOV 1; PBOV1; PBOV1_HUMAN; Prostate and breast cancer overexpressed 1; Prostate and breast cancer overexpressed gene 1 protein; Protein UROC28; UC28; UROC28;
Immunogens
A synthesized peptide derived from human PBOV1, corresponding to a region within the internal amino acids.
Expressed in colon, prostate, small intestine, testis and spleen, with lower expression in thymus, ovary, and peripheral blood leukocytes. Up-regulated expression in prostate, breast, and bladder cancer, but not in lung and colon cancer.
- Q9GZY1 PBOV1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLECCLLYLSKTIHPQII
Research Backgrounds
Cytoplasm. Nucleus.
Expressed in colon, prostate, small intestine, testis and spleen, with lower expression in thymus, ovary, and peripheral blood leukocytes. Up-regulated expression in prostate, breast, and bladder cancer, but not in lung and colon cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.