AVEN Antibody - #DF3519
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3519, RRID:AB_2835739.
Fold/Unfold
1700013A01Rik; 1700056A21Rik; Apoptosis caspase activation inhibitor; AVEN; AVEN_HUMAN; Cell death regulator Aven; mAven L; mAven S; MGC124011; OTTMUSP00000016129; PDCD12; Programmed cell death 12; RP23-52C15.2;
Immunogens
Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.
- Q9NQS1 AVEN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS
PTMs - Q9NQS1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R17 | Methylation | Uniprot | |
| R28 | Methylation | Uniprot | |
| R37 | Methylation | Uniprot | |
| R50 | Methylation | Uniprot | |
| S94 | Phosphorylation | Uniprot | |
| T98 | Phosphorylation | Uniprot | |
| Y99 | Phosphorylation | Uniprot | |
| Y109 | Phosphorylation | Uniprot | |
| S116 | Phosphorylation | Uniprot | |
| Y121 | Phosphorylation | Uniprot | |
| S135 | Phosphorylation | Q13315 (ATM) | Uniprot |
| S151 | Phosphorylation | Uniprot | |
| K161 | Ubiquitination | Uniprot | |
| K215 | Ubiquitination | Uniprot | |
| K217 | Ubiquitination | Uniprot | |
| K230 | Methylation | Uniprot | |
| K230 | Ubiquitination | Uniprot | |
| R238 | Methylation | Uniprot | |
| K245 | Methylation | Uniprot | |
| K245 | Ubiquitination | Uniprot | |
| S261 | Phosphorylation | Uniprot | |
| S265 | Phosphorylation | Uniprot | |
| S268 | Phosphorylation | Uniprot | |
| S273 | Phosphorylation | Uniprot | |
| S308 | Phosphorylation | Q13315 (ATM) | Uniprot |
| C326 | S-Nitrosylation | Uniprot | |
| S330 | Phosphorylation | Uniprot |
Research Backgrounds
Protects against apoptosis mediated by Apaf-1.
Endomembrane system>Peripheral membrane protein.
Note: Associated with intracellular membranes.
Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.
Binds Apaf-1, BCL-2 and BAD (Bcl-xl).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.