CD160 Antibody - #DF3522
Product: | CD160 Antibody |
Catalog: | DF3522 |
Description: | Rabbit polyclonal antibody to CD160 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Horse, Dog |
Mol.Wt.: | 17 KD; 20kD(Calculated). |
Uniprot: | O95971 |
RRID: | AB_2835742 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3522, RRID:AB_2835742.
Fold/Unfold
BY55; BY55_HUMAN; CD160; CD160 antigen [Precursor]; CD160 antigen; CD160 delta Ig; CD160 molecule; CD160 transmembrane isoform; FLJ46513; Natural killer cell receptor BY55; Natural killer cell receptor, immunoglobulin superfamily member; NK1; NK28;
Immunogens
Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at protein level) (PubMed:9743336, PubMed:18193050, PubMed:11978774, PubMed:25255144). Expressed at high levels in intraepithelial lymphocytes (at protein level) (PubMed:9743336). Expressed in both alpha-beta and gamma-delta CD8+ T cell subsets (at protein level) (PubMed:9743336, PubMed:18193050, PubMed:11978774). Expressed in umbilical vein endothelial cells (at protein level) (PubMed:16809620). Expressed in monocytes and at lower levels in B cells (PubMed:23761635). Isoform 3: Expressed exclusively in activated NK cells (at protein level) (PubMed:19109136).
- O95971 BY55_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95971 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S65 | Phosphorylation | Uniprot | |
S69 | Phosphorylation | Uniprot | |
T72 | Phosphorylation | Uniprot | |
S73 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells. Receptor for both classical and non-classical MHC class I molecules. In the context of acute viral infection, recognizes HLA-C and triggers NK cell cytotoxic activity, likely playing a role in anti-viral innate immune response. On CD8+ T cells, binds HLA-A2-B2M in complex with a viral peptide and provides a costimulatory signal to activated/memory T cells. Upon persistent antigen stimulation, such as occurs during chronic viral infection, may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion. On endothelial cells, recognizes HLA-G and controls angiogenesis in immune privileged sites. Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response (By similarity). On activated CD4+ T cells, interacts with TNFRSF14 and downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response. In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and proinflammatory cytokines (By similarity).
The soluble GPI-cleaved form, usually released by activated lymphocytes, might play an immune regulatory role by limiting lymphocyte effector functions.
Cell membrane>Lipid-anchor.
Secreted.
Note: Released from the cell membrane by GPI cleavage.
Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at protein level). Expressed at high levels in intraepithelial lymphocytes (at protein level). Expressed in both alpha-beta and gamma-delta CD8+ T cell subsets (at protein level). Expressed in umbilical vein endothelial cells (at protein level). Expressed in monocytes and at lower levels in B cells. Isoform 3: Expressed exclusively in activated NK cells (at protein level).
Homomultimer; disulfide-linked (Probable). Interacts with HLA-G. Interacts with HLA-A2-B2M in complex with an HIV-derived peptide. Interacts with TNFRSF14 (via cysteine-rich domain 1); this interaction is direct. Interacts with LCK and CD247/CD3 zeta chain.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.