ORAOV1 Antibody - #DF3373
| Product: | ORAOV1 Antibody |
| Catalog: | DF3373 |
| Description: | Rabbit polyclonal antibody to ORAOV1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 15 KD; 15kD(Calculated). |
| Uniprot: | Q8WV07 |
| RRID: | AB_2835755 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3373, RRID:AB_2835755.
Fold/Unfold
Oral cancer overexpressed 1; Oral cancer overexpressed protein 1 A; Oral cancer-overexpressed protein 1; ORAOV1; ORAOV1 oral cancer overexpressed 1; ORAV1_HUMAN; TAOS1; Tumor amplified and overexpressed sequence 1; Tumor-amplified and overexpressed sequence 1;
Immunogens
A synthesized peptide derived from human ORAOV1, corresponding to a region within the internal amino acids.
- Q8WV07 LTO1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Research Backgrounds
The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery. May be required for biogenesis of the large ribosomal subunit and initiation of translation. May play a role in the regulation of proline metabolism and ROS production.
Nucleus.
Widely expressed. Highly expressed in placenta, kidney and skeletal muscle.
Belongs to the LTO1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.