DLX4 Antibody - #DF3387

Product: | DLX4 Antibody |
Catalog: | DF3387 |
Description: | Rabbit polyclonal antibody to DLX4 |
Application: | WB IF/ICC |
Cited expt.: | |
Reactivity: | Human |
Prediction: | Bovine, Sheep, Dog |
Mol.Wt.: | 34 KD; 26kD(Calculated). |
Uniprot: | Q92988 |
RRID: | AB_2835769 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3387, RRID:AB_2835769.
Fold/Unfold
Beta protein 1; BP1; Distal less homeo box 7; Distal less homeo box 9; distal-less homeobox 4; DLX4; DLX4_HUMAN; DLX7; DLX8; DLX9; Homeobox protein DLX-4; Homeobox protein DLX-7; Homeobox protein DLX-8; Homeobox protein DLX4;
Immunogens
A synthesized peptide derived from human DLX4, corresponding to a region within the internal amino acids.
Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver.
- Q92988 DLX4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May play a role in determining the production of hemoglobin S. May act as a repressor. During embryonic development, plays a role in palatogenesis.
Nucleus.
Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver.
Belongs to the distal-less homeobox family.
References
Application: IHC Species: Human Sample: ccRCC tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.