MOBKL2A/B Antibody - #DF3395
Product: | MOBKL2A/B Antibody |
Catalog: | DF3395 |
Description: | Rabbit polyclonal antibody to MOBKL2A/B |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 25 KD; 25kD(Calculated). |
Uniprot: | Q96BX8 | Q86TA1 |
RRID: | AB_2835777 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3395, RRID:AB_2835777.
Fold/Unfold
MOB-LAK; Mob1 homolog 2A; MOBKL2A; MOL2A_HUMAN; Mps one binder kinase activator-like 2A; Protein Mob3A; Mob1 homolog 2b; MOB1 Mps One Binder kinase activator like 2B (yeast); MOB1 Mps One Binder kinase activator like 2B; MOB3B; MOBKL2B; MOL2B_HUMAN; monopolar spindle 1 binding MOB1 domain containing; Mps one binder kinase activator-like 2B; Protein Mob3B;
Immunogens
- Q96BX8 MOB3A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH
- Q86TA1 MOB3B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96BX8/Q86TA1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T14 | Phosphorylation | Uniprot | |
K20 | Ubiquitination | Uniprot | |
T25 | Phosphorylation | Uniprot | |
T77 | Phosphorylation | Uniprot | |
K208 | Ubiquitination | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
K7 | Ubiquitination | Uniprot | |
T15 | Phosphorylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
T26 | Phosphorylation | Uniprot | |
S38 | Phosphorylation | Uniprot | |
K96 | Sumoylation | Uniprot | |
K106 | Ubiquitination | Uniprot | |
K109 | Ubiquitination | Uniprot | |
T111 | Phosphorylation | Uniprot | |
S114 | Phosphorylation | Uniprot | |
K203 | Ubiquitination | Uniprot | |
K209 | Ubiquitination | Uniprot |
Research Backgrounds
May regulate the activity of kinases.
Belongs to the MOB1/phocein family.
Modulates LATS1 expression in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis.
Belongs to the MOB1/phocein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.