RASD2 Antibody - #DF3396
Product: | RASD2 Antibody |
Catalog: | DF3396 |
Description: | Rabbit polyclonal antibody to RASD2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 35 KD; 30kD(Calculated). |
Uniprot: | Q96D21 |
RRID: | AB_2835778 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3396, RRID:AB_2835778.
Fold/Unfold
GTP binding protein Rhes; GTP-binding protein Rhes; MGC:4834; OTTHUMP00000197925; Ras homolog enriched in striatum; RASD 2; RASD family member 2; RASD2; Rhes; RHES_HUMAN; TEM 2; TEM2; Tumor endothelial marker 2;
Immunogens
A synthesized peptide derived from human RASD2, corresponding to a region within the internal amino acids.
- Q96D21 RHES_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination.
Farnesylated. Farnesylation is required for membrane targeting (By similarity).
Cell membrane>Lipid-anchor.
Pancreatic endocrine cells (islets of Langerhans).
Belongs to the small GTPase superfamily. RasD family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.