DUSP22 Antibody - #DF3445
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3445, RRID:AB_2835811.
Fold/Unfold
Dual specificity protein phosphatase 22; DUS22_HUMAN; Dusp22; JNK stimulatory phosphatase 1; JNK-stimulatory phosphatase-1; JSP 1; JSP-1; JSP1; LMW DSP2; LMW-DSP2; Low molecular weight dual specificity phosphatase 2; MAP kinase phosphatase x; Mitogen activated protein kinase phosphatase x; Mitogen-activated protein kinase phosphatase x; MKP-x; MKPX;
Immunogens
Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.
- Q9NRW4 DUS22_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NRW4 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| G2 | Myristoylation | Uniprot | |
| K18 | Ubiquitination | Uniprot | |
| S36 | Phosphorylation | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| S60 | Phosphorylation | Uniprot | |
| K151 | Ubiquitination | Uniprot | |
| K166 | Ubiquitination | Uniprot |
Research Backgrounds
Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).
Myristoylation regulates subcellular location, and is necessary for activation of JNK.
Cytoplasm. Nucleus.
Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.
Monomer.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.