CREBZF Antibody - #DF3447
Product: | CREBZF Antibody |
Catalog: | DF3447 |
Description: | Rabbit polyclonal antibody to CREBZF |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 26 KD; 37kD(Calculated). |
Uniprot: | Q9NS37 |
RRID: | AB_2835813 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3447, RRID:AB_2835813.
Fold/Unfold
1110034C16Rik; 6330417B10Rik; AI225749; AI606244; CREB/ATF bZIP transcription factor; Crebzf; FLJ94018; HCF-binding transcription factor Zhangfei; Host cell factor-binding transcription factor Zhangfei; LAZip; LAZipII; SHP-interacting leucine zipper protein; SMILE; ZF; ZHANG_HUMAN;
Immunogens
In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, lung and liver.
- Q9NS37 ZHANG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NS37 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S14 | Phosphorylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot | |
T28 | Phosphorylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
T45 | Phosphorylation | Uniprot | |
S50 | Phosphorylation | Uniprot | |
S174 | Phosphorylation | Uniprot | |
S179 | Phosphorylation | Uniprot | |
K184 | Ubiquitination | Uniprot | |
S189 | Phosphorylation | Uniprot | |
S198 | Phosphorylation | Uniprot | |
T207 | Phosphorylation | Uniprot | |
K208 | Ubiquitination | Uniprot | |
S209 | Phosphorylation | Uniprot | |
T275 | Phosphorylation | Uniprot | |
S282 | Phosphorylation | Uniprot | |
S285 | Phosphorylation | Uniprot | |
S294 | Phosphorylation | Uniprot | |
S299 | Phosphorylation | Uniprot | |
K312 | Ubiquitination | Uniprot |
Research Backgrounds
Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Nucleus.
Note: Colocalizes in promyelocytic leukemia protein nuclear bodies (PML-NB) with CREB3 and HCFC1.
In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, lung and liver.
Interacts with HCFC1; the interaction inhibits CREB3 transcriptional activity. Interacts with CREB3; the interaction occurs only in combination with HCFC1.
Belongs to the bZIP family. ATF subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.