YBOX2 Antibody - #DF3482
| Product: | YBOX2 Antibody |
| Catalog: | DF3482 |
| Description: | Rabbit polyclonal antibody to YBOX2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 38 KD; 39kD(Calculated). |
| Uniprot: | Q9Y2T7 |
| RRID: | AB_2835845 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3482, RRID:AB_2835845.
Fold/Unfold
Contrin; CSDA 3; CSDA3; Dbpc; DNA binding protein C; DNA-binding protein C; FRGY2 homolog; Germ cell specific Y box binding protein; Germ cell-specific Y-box-binding protein; MGC118270; MGC45104; MSY 2; MSY2; MSY2 homolog; OTTMUSP00000006276; RGD1305068; Y box binding protein 2; Y-box-binding protein 2; YBOX2_HUMAN; YBX 2; YBX2;
Immunogens
Expressed in oocytes and testicular germ cells in the stage of spermatogonia to spermatocyte. Also observed placental trophoblasts, as well as in vascular smooth muscle cells in the pulmonary artery, myocardium, and skeletal muscle. Undetectable in epithelial cells in respiratory, gastrointestinal, and urogenital tracts. Up-regulated in various carcinomas and germ cell tumors (at protein level).
- Q9Y2T7 YBOX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2T7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T57 | Phosphorylation | Uniprot | |
| T65 | Phosphorylation | Uniprot | |
| T76 | Phosphorylation | Uniprot | |
| K99 | Acetylation | Uniprot | |
| K99 | Ubiquitination | Uniprot | |
| Y107 | Phosphorylation | Uniprot | |
| T115 | Phosphorylation | O14757 (CHEK1) | Uniprot |
| K116 | Acetylation | Uniprot | |
| K116 | Ubiquitination | Uniprot | |
| K127 | Ubiquitination | Uniprot | |
| S137 | Phosphorylation | Uniprot | |
| T158 | Phosphorylation | Uniprot | |
| T161 | Phosphorylation | Uniprot | |
| S189 | Phosphorylation | Uniprot | |
| S208 | Phosphorylation | Uniprot | |
| T250 | Phosphorylation | Uniprot | |
| Y324 | Phosphorylation | Uniprot |
Research Backgrounds
Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full-length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding with maternal mRNAs is necessary for its cytoplasmic retention. May mark specific mRNAs (those transcribed from Y-box promoters) in the nucleus for cytoplasmic storage, thereby linking transcription and mRNA storage/translational delay (By similarity).
Phosphorylated during oocyte maturation and dephosphorylated following egg activation. Phosphorylated in vitro by a kinase activity associated with testicular mRNPs. Dephosphorylation leads to a decrease in its affinity to bind RNA in vitro (By similarity).
Cytoplasm. Nucleus.
Expressed in oocytes and testicular germ cells in the stage of spermatogonia to spermatocyte. Also observed placental trophoblasts, as well as in vascular smooth muscle cells in the pulmonary artery, myocardium, and skeletal muscle. Undetectable in epithelial cells in respiratory, gastrointestinal, and urogenital tracts. Up-regulated in various carcinomas and germ cell tumors (at protein level).
Found in a mRNP complex with PABPC1 and YBX3.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.