SPIN1 Antibody - #DF3488
| Product: | SPIN1 Antibody |
| Catalog: | DF3488 |
| Description: | Rabbit polyclonal antibody to SPIN1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 30 KD; 30kD(Calculated). |
| Uniprot: | Q9Y657 |
| RRID: | AB_2835850 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3488, RRID:AB_2835850.
Fold/Unfold
OCR; Ovarian cancer-related protein; SPIN; Spin1; SPIN1_HUMAN; Spindlin-1;
Immunogens
- Q9Y657 SPIN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y657 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K2 | Methylation | Uniprot | |
| T3 | Phosphorylation | Uniprot | |
| K7 | Acetylation | Uniprot | |
| K7 | Methylation | Uniprot | |
| S13 | Phosphorylation | Uniprot | |
| K28 | Acetylation | Uniprot | |
| S38 | Phosphorylation | Uniprot | |
| S39 | Phosphorylation | Uniprot | |
| S43 | Phosphorylation | Uniprot | |
| K44 | Ubiquitination | Uniprot | |
| S47 | Phosphorylation | Uniprot | |
| K63 | Ubiquitination | Uniprot | |
| Y91 | Phosphorylation | Uniprot | |
| Y98 | Phosphorylation | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| S109 | Phosphorylation | Uniprot | |
| T120 | Phosphorylation | Uniprot | |
| S121 | Phosphorylation | Uniprot | |
| S124 | Phosphorylation | Uniprot | |
| T131 | Phosphorylation | Uniprot | |
| K186 | Ubiquitination | Uniprot | |
| S196 | Phosphorylation | Uniprot | |
| S199 | Phosphorylation | Uniprot | |
| K216 | Ubiquitination | Uniprot | |
| K222 | Acetylation | Uniprot |
Research Backgrounds
Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway. Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes. May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.
Phosphorylated during oocyte meiotic maturation.
Nucleus. Nucleus>Nucleolus.
Highly expressed in ovarian cancer tissues.
Homodimer; may form higher-order oligomers. Interacts with TCF7L2/TCF4; the interaction is direct. Interacts with HABP4 and SERBP1 (By similarity). Interacts with C11orf84/SPINDOC.
The 3 tudor-like domains (also named Spin/Ssty repeats) specifically recognize and bind methylated histones (PubMed:23077255, PubMed:24589551). H3K4me3 and H3R8me2a are recognized by tudor-like domains 2 and 1, respectively (PubMed:24589551).
Belongs to the SPIN/STSY family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.