EID1 Antibody - #DF3489
| Product: | EID1 Antibody |
| Catalog: | DF3489 |
| Description: | Rabbit polyclonal antibody to EID1 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 21 KD; 21kD(Calculated). |
| Uniprot: | Q9Y6B2 |
| RRID: | AB_2835851 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3489, RRID:AB_2835851.
Fold/Unfold
21 kDa pRb associated protein; 21 kDa pRb-associated protein; C15orf3; CBP; Chromosome 15 open reading frame 3; CREBBP/EP300 inhibitor 1; CREBBP/EP300 inhibitory protein 1; CRI 1; CRI1; E1A like inhibitor of differentiation; E1A-like inhibitor of differentiation 1; EID 1; EID-1; EID1; EID1_HUMAN; EP300 interacting inhibitor of differentiation 1; EP300-interacting inhibitor of differentiation 1; IRO45620; MGC138883; MGC138884; NB4 apoptosis related protein; PNAS 22; PNAS22; PTD014; Rb and p300 binding protein EID 1; Rb and p300 binding protein EID1; RBP21; Retinoblastoma protein associated protein;
Immunogens
A synthesized peptide derived from human EID1, corresponding to a region within the internal amino acids.
Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A-549 and various leukemia cell lines.
- Q9Y6B2 EID1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms.
Ubiquitinated in U2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit.
Nucleus. Cytoplasm.
Note: May shuttle between nucleus and cytoplasm.
Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A-549 and various leukemia cell lines.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.