14-3-3 epsilon Antibody - #DF3491
| Product: | 14-3-3 epsilon Antibody |
| Catalog: | DF3491 |
| Description: | Rabbit polyclonal antibody to 14-3-3 epsilon |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 29 KD; 29kD(Calculated). |
| Uniprot: | P62258 |
| RRID: | AB_2835853 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3491, RRID:AB_2835853.
Fold/Unfold
14 3 3 E; 14 3 3 epsilon; 14 3 3E; 14-3-3 protein epsilon; 14-3-3E; 1433E_HUMAN; Epididymis luminal protein 2; FLJ45465; FLJ53559; HEL2; KCIP 1; KCIP1; MDCR; MDS; Mitochondrial import stimulation factor L subunit; Protein kinase C inhibitor protein1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein epsilon polypeptide; YWHAE;
Immunogens
A synthesized peptide derived from human 14-3-3 epsilon, corresponding to a region within C-terminal amino acids.
- P62258 1433E_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner (By similarity). Positively regulates phosphorylated protein HSF1 nuclear export to the cytoplasm.
Nucleus. Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.