Product: 5-HT-4 Antibody
Catalog: DF3503
Description: Rabbit polyclonal antibody to 5-HT-4
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Sheep, Rabbit
Mol.Wt.: 43 KD; 44kD(Calculated).
Uniprot: Q13639
RRID: AB_2835865

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(82%), Sheep(82%), Rabbit(91%)
Clonality:
Polyclonal
Specificity:
5-HT-4 Antibody detects endogenous levels of total 5-HT-4.
RRID:
AB_2835865
Cite Format: Affinity Biosciences Cat# DF3503, RRID:AB_2835865.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

5 HT 4; 5 HT4; 5 HT4R; 5 hydroxytryptamine (serotonin) receptor 4, G protein coupled; 5 hydroxytryptamine 4 receptor; 5 hydroxytryptamine receptor 4; 5 hydroxytryptamine serotonin receptor 4; 5 hydroxytryptamine4 receptor; 5-HT-4; 5-ht4; 5-HT4R; 5H4; 5HT 4; 5HT4; 5ht4 receptor; 5HT4R; Cardiac 5 HT4 receptor; HTR 4; HTR4; serotonin 4 receptor; Serotonin 5 HT4 receptor; serotonin 5-ht-4 receptor; serotonin 5-ht-4a; Serotonin receptor 4;

Immunogens

Immunogen:

A synthesized peptide derived from human 5-HT-4, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q13639 5HT4R_HUMAN:

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.

Sequence:
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
91
Bovine
82
Sheep
82
Pig
0
Horse
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Endosome.
Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Organismal Systems > Nervous system > Serotonergic synapse.

References

1). Tryptophan Metabolism Acts as a New Anti-Ferroptotic Pathway to Mediate Tumor Growth. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2023 (PubMed: 36627132) [IF=15.1]

Application: WB    Species: Mouse    Sample:

Figure 2 5-HT mediated ferroptosis resistance is independent of canonical anti-ferroptosis pathway. A) Western blot analysis of 5-HT receptors in a panel of cancer cell lines. B) HT1080 cells expressing shRNA of 5-HT receptors were treated with RSL3 (200 nm) and 5-HT (10 µm). Cell viability was assessed 24 h thereafter using CCK8. C) Western blot analysis of arrestin β1 and arrestin β2 in 293T arrestin β1-/-, arrestin β2-/- DKO cells. D) Cell death measurement of 293T arrestin β1-/-, arrestin β2-/- DKO cells treated with RSL3 (2.5 µm) and Fer-1 (1 µm) for 8 h. E) Western blot analysis of p-mTOR and p-AMPK in a panel of cell lines upon 5-HT treatment (10 µm) for 12 h. F) RNA-seq analysis of HT1080 cells with or without 5-HT treatment (10 µm) for 12 h. G) Volcano plots showing the alteration of phospholipid components in HT1080 cells treated with 5-HT (10 µm) for 12 h.

2). Prucalopride might improve intestinal motility by promoting the regeneration of the enteric nervous system in diabetic rats. International Journal of Molecular Medicine, 2022 (PubMed: 35543167) [IF=5.7]

Application: IF/ICC    Species: Rat    Sample:

Figure 5 Immunofluorescence double staining images of Nestin and 5-HT4 in the Control, DM, DM + A and DM + B groups. DAPI-stained nuclei appeared blue. Nestin and 5-HT4 are indicated by red fluorescence and green fluorescence, respectively. A rat model of DM was established using an intraperitoneal injection of streptozotocin. The rats in the Control group were given an equal volume of citric acid solvent. Magnification, ×100. *P<0.05 vs. Control; #P<0.05 vs. DM. DM, diabetes mellitus model; DM + A, diabetic rats treated with 5 µg/kg prucalopride; DM + B, diabetic rats treated with 10 µg/kg prucalopride; 5-HT4, 5-hydroxytryptamine 4.

3). Bilirubin Induces Pain Desensitization in Cholestasis by Activating 5-Hydroxytryptamine 3A Receptor in Spinal Cord. Frontiers in Cell and Developmental Biology, 2021 (PubMed: 33869168) [IF=4.6]

Application: WB    Species: rat    Sample: spinal cord

FIGURE 2 | Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord. (C) Intrathecal administration of bilirubin increased 5-HT3A receptor expression without changing other subtypes.

Application: WB    Species: Rat    Sample: spinal cords

FIGURE 2 Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord. (A) 5-HT3A receptor expression increased gradually in spinal cord enlargement of BDL rats, whereas expression of 5-HT3B, 5-HT3C, 5-HT3D, and 5-HT3E receptors did not change significantly. (B) The quantitative analysis of 5-HT3A receptor expression in BDL rats. (C) Intrathecal administration of bilirubin increased 5-HT3A receptor expression without changing other subtypes. (D) The quantitative analysis of 5-HT3A receptor expression after intrathecal administration of bilirubin in normal rats. (E) SDHNs cultured with bilirubin showed increased 5-HT3A receptor expression without changing other subtypes. (F) The quantitative analysis of 5-HT3A receptor expression in SDHNs. (G) Immunofluorescence showed that 5-HT3A receptor expression increased in laminas I and II in the spinal cords of BDL rats. The increased C-Fos protein (marker of neuron activity) expression indicated that neuron activities were also enhanced in the spinal cords of BDL rats. *P < 0.05.

4). Qi Lang formula relieves constipation via targeting SCF/c-kit signaling pathway: An integrated study of network pharmacology and experimental validation. Heliyon, 2024 (PubMed: 38841509) [IF=4.0]

5). Mechanism of action of FoxiangSan in diabetic gastroparesis: Gut microbiota and cAMP/PKA pathway. Heliyon, 2024 (PubMed: 39211931) [IF=4.0]

6). scRNA-Seq and Network Pharmacology Analysis Reveal SCF/C-kit as the Targeting Mechanism of Qi Lang Formula Relieving Constipation. , 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.