Histone H1.0 Antibody - #AF0359
| Product: | Histone H1.0 Antibody |
| Catalog: | AF0359 |
| Description: | Rabbit polyclonal antibody to Histone H1.0 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Xenopus |
| Mol.Wt.: | 20kDa; 21kD(Calculated). |
| Uniprot: | P07305 |
| RRID: | AB_2833524 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0359, RRID:AB_2833524.
Fold/Unfold
H1 histone family member 0; H1(0); H10; H10_HUMAN; h1f0; H1FV; Histone H1''; Histone H1(0); Histone H1.0; Histone H10; Histone H5; MGC5241; N-terminally processed;
Immunogens
A synthesized peptide derived from human Histone H1.0, corresponding to a region within the internal amino acids.
- P07305 H10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The histones H1.0 are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
Phosphorylated on Ser-17 in RNA edited version.
ADP-ribosylated on Ser-104 in response to DNA damage.
Nucleus. Chromosome.
Note: The RNA edited version has been localized to nuclear speckles. During mitosis, it appears in the vicinity of condensed chromosomes.
Belongs to the histone H1/H5 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.