AIG1 Antibody - #DF3777
| Product: | AIG1 Antibody |
| Catalog: | DF3777 |
| Description: | Rabbit polyclonal antibody to AIG1 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 32 KD; 28kD(Calculated). |
| Uniprot: | Q9NVV5 |
| RRID: | AB_2835902 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3777, RRID:AB_2835902.
Fold/Unfold
A2LD1; AIG 1; AIG-1; AIG1; AIG1_HUMAN; Androgen induced 1; Androgen induced protein (AIG-1); Androgen induced protein (AIG-1), C-terminus truncated; Androgen-induced gene 1 protein; dJ95L4.1; DKFZp686F03136; FLJ10485; GGACT; RP1 95L4.1;
Immunogens
A synthesized peptide derived from human AIG1, corresponding to a region within C-terminal amino acids.
Highly expressed in heart, ovary, testis, liver, and kidney, at lower levels in spleen, prostate, brain, skeletal muscle, pancreas, small intestine and colon, and undetected in peripheral blood leukocytes, thymus, lung and placenta. AIG1 expression is higher in hair follicles from males than from females.
- Q9NVV5 AIG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKKPPSWQDMKIKFMYLGPSS
Research Backgrounds
Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids.
Cell membrane>Multi-pass membrane protein.
Highly expressed in heart, ovary, testis, liver, and kidney, at lower levels in spleen, prostate, brain, skeletal muscle, pancreas, small intestine and colon, and undetected in peripheral blood leukocytes, thymus, lung and placenta. AIG1 expression is higher in hair follicles from males than from females.
Belongs to the AIG1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.